PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DL_4E6EA6F5B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family VOZ
Protein Properties Length: 381aa    MW: 43236.2 Da    PI: 4.9352
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DL_4E6EA6F5B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ421.31.5e-129863031217
                    VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatak 87 
                            p+p++fl+pkcalwdc+rpaqgse +qdycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vg+p+cegaat+k
  Traes_3DL_4E6EA6F5B.1  86 PAPASFLRPKCALWDCPRPAQGSESWQDYCSMYHAELAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGVPVCEGAATTK 173
                            89*************************************9879********************************************* PP

                    VOZ  88 spwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyein 175
                            spwna+elfdl ++ege++rewlffdkprraf+sgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhlyeyein
  Traes_3DL_4E6EA6F5B.1 174 SPWNAPELFDLYIFEGESMREWLFFDKPRRAFDSGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLYEYEIN 261
                            **************************************************************************************** PP

                    VOZ 176 eldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                            + da+alyrle+k++++kksak+k ++++l ++q++++rl+a
  Traes_3DL_4E6EA6F5B.1 262 DRDAFALYRLEFKSSEAKKSAKSKFTCSPLIEIQQQMVRLSA 303
                            ****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MSFQMYYVNQ ELSVEDFLYD DDYKINLPGS NPEILNNLEG IGHQEYLQFN LPQELPPNAY  60
LDMNNYGQNA GDGFLHMSDL LTTMSPAPAS FLRPKCALWD CPRPAQGSES WQDYCSMYHA  120
ELAVKEEGPP GTMPVIRPRG IDLKDGPLFA ALSAKIQGKH VGVPVCEGAA TTKSPWNAPE  180
LFDLYIFEGE SMREWLFFDK PRRAFDSGNR KQRSLPDYNG RGWHESRKQV MKDFGGLKRS  240
YYMDPQPSSS YEWHLYEYEI NDRDAFALYR LEFKSSEAKK SAKSKFTCSP LIEIQQQMVR  300
LSADGHVENK RTARVRTQDV STNIYPVQNN TAQASAPDAY QAASQVDQMT FLNGSVVYGP  360
HLPYGYSTEG GDFYWNSNDG A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631850.0AK363185.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013F10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569827.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-120VOZ1_ARATH; Transcription factor VOZ1
TrEMBLW5D9S40.0W5D9S4_WHEAT; Uncharacterized protein
STRINGMLOC_75554.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-113vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]